RAX2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAX2 Polyclonal antibody (11466-1-AP)

RAX2 Polyclonal Antibody for WB, ELISA

Cat No. 11466-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ARMD6, CORD11, Q50-type retinal homeobox protein, QRX, RAXL1

• 

  WB analysis of Jurkat using 11466-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11466-1-AP (RAX2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAX2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11466-1-AP targets RAX2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2046

  Product name: Recombinant human RAX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC018709

  Sequence: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA

• Full Name: retina and anterior neural fold homeobox 2
• Calculated Molecular Weight: 184 aa, 20 kDa
• Observed Molecular Weight: 22-27 kDa
• GenBank Accession Number: BC018709
• Gene Symbol: RAX2
• Gene ID (NCBI): 84839
• RRID: AB_2877764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IS3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RAX2 Polyclonal antibody (Catalog No. 11466-1-AP) has 1 total citation. It was cited in Cell Death & Disease (Impact Factor 12.2), in a study investigating PABPC1-induced stabilization of BDNF-AS and its role in inhibiting malignant progression of glioblastoma cells via STAU1-mediated decay. The research field is glioblastoma/cancer biology, with the antibody applied in Western Blot for human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; PABPC1-induced stabilization of BDNF-AS inhibits malignant progression of glioblastoma cells through STAU1-mediated decay.; Authors - Rui Su