• Featured Product
  • KD/KO Validated

RB1CC1 Polyclonal antibody

RB1CC1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 21269-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

RBICC, RB1-inducible coiled-coil protein 1, RB1CC 1, KIAA0203, FAK family kinase-interacting protein of 200 kDa

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, HEK-293 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21269-1-AP targets RB1CC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15739

Product name: Recombinant human RB1CC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC017556

Sequence: MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQLALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAETKRSTELVLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQT

Predict reactive species
Full Name RB1-inducible coiled-coil 1
Calculated Molecular Weight 1594 aa, 183 kDa
Observed Molecular Weight 200 kDa
GenBank Accession NumberBC017556
Gene Symbol RB1CC1
Gene ID (NCBI) 9821
RRIDAB_10733100
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TDY2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RB1CC1, also named as RBICC, is implicated in the regulation of RB1 expression and functions as a DNA-binding transcription factor. It is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. Its expression is, thus, a prerequisite for myogenic differentiation. Involved in autophagy. RB1CC1 is required for autophagosome formation. It is probably involved in the tumorigenesis of breast cancer. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human RB1CC1.

Protocols

Product Specific Protocols
IHC protocol for RB1CC1 antibody 21269-1-APDownload protocol
WB protocol for RB1CC1 antibody 21269-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...