RB1CC1 Monoclonal antibody, PBS Only

RB1CC1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68564-1-PBS
Clone No.1G8C8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

RB1-inducible coiled-coil protein 1, RB1CC 1, KIAA0203, FAK family kinase-interacting protein of 200 kDa, CC1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68564-1-PBS targets RB1CC1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10508

Product name: Recombinant human RB1CC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1241-1594 aa of BC017556

Sequence: AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

Predict reactive species
Full Name RB1-inducible coiled-coil 1
Calculated Molecular Weight 1594 aa, 183 kDa
Observed Molecular Weight200 kDa
GenBank Accession NumberBC017556
Gene Symbol RB1CC1
Gene ID (NCBI) 9821
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8TDY2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RB1CC1, also named as RBICC or FIP200, is implicated in the regulation of RB1 expression and functions as a DNA-binding transcription factor. It is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. Its expression is, thus, a prerequisite for myogenic differentiation. Involved in autophagy. RB1CC1 is required for autophagosome formation. It is probably involved in the tumorigenesis of breast cancer. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene.

Loading...
||
New chat Able
正在加载,请稍候...