RBCK1 Polyclonal antibody

• 

  IP experiment of human placenta using 26367-1-AP

  IP result of anti-RBCK1 (IP:26367-1-AP, 4ug; Detection:26367-1-AP 1:300) with human placenta tissue lysate 1520ug.

• 

  IHC staining of human placenta using 26367-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26367-1-AP (RBCK1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 26367-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26367-1-AP (RBCK1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

RBCK1 Polyclonal Antibody for IP, IHC, ELISA

Cat No. 26367-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

C20orf18, HBV associated factor 4, HOIL 1, HOIL1, RBCK1, RBCK2, RING finger protein 54, RNF54, UBCE7IP3, XAP3, XAP4, ZRANB4

---

Tested Applications

• Positive IP detected in: human placenta tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 9 publications below
• IHC: See 4 publications below
• IF: See 1 publications below
• IP: See 2 publications below

Product Information

26367-1-AP targets RBCK1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24405

  Product name: Recombinant human RBCK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 225-500 aa of BC015219

  Sequence: EERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH

• Full Name: RanBP-type and C3HC4-type zinc finger containing 1
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC015219
• Gene Symbol: RBCK1
• Gene ID (NCBI): 10616
• RRID: AB_2880493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYM8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IF,IP	Cell Death Dis; RBCK1 regulates the progression of ER-positive breast cancer through the HIF1α signaling; Authors - Zhiguo Niu
human	WB,IHC	Oncogene; The E3 ligase RBCK1 reduces the sensitivity of ccRCC to sunitinib through the ANKRD35-MITD1-ANXA1 axis; Authors - Yapeng Wang ; KD Validated
human	IHC,WB	Front Immunol; Crosstalk of necroptosis and pyroptosis defines tumor microenvironment characterization and predicts prognosis in clear cell renal carcinoma; Authors - Liangmin Fu
human	IHC	Hum Cell; Regulation of PTEN and ovarian cancer progression by an E3 ubiquitin ligase RBCK1.; Authors - Guanghui Wang ; KD Validated
human	WB	Biochem Biophys Res Commun; Mechanistic insights into the homo-dimerization of HOIL-1L and SHARPIN; Authors - Yan Zhang
human	WB	BMC Musculoskelet Disord; Polyglucosan body myopathy 1 may cause cognitive impairment: a case report from China.; Authors - Lin Chen