RBL1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array sample test of MP02868-1

  The mean p107 concentration was determined to be 50.3 ng/mL in MCF-7 cell extract based on a 1.2 mg/mL extract load, 29.2 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02868-1

  Cytometric bead array standard curve of MP02868-1, p107 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87119-2-PBS. Detection antibody: 87119-1-PBS. Standard: Ag4146. Range: 0.469-60 ng/mL.

RBL1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 87119-2-PBS

Clone No.252269A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

p107, 107 kDa retinoblastoma-associated protein, CP107, PRB1, retinoblastoma like 1 (p107)

---

Product Information

87119-2-PBS targets RBL1 as part of a matched antibody pair:

MP02868-1: 87119-2-PBS capture and 87119-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4146

  Product name: Recombinant human RBL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC032247

  Sequence: MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLACSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFTASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSKAVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANV

• Full Name: retinoblastoma-like 1 (p107)
• Calculated Molecular Weight: 1068 aa, 119 kDa
• GenBank Accession Number: BC032247
• Gene Symbol: p107
• Gene ID (NCBI): 5933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28749
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.