RBM12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBM12 Polyclonal antibody, PBS Only (30990-1-PBS)

• 

  WB analysis using 30990-1-AP (same clone as 30990-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30990-1-AP (RBM12 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30990-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 30990-1-AP (same clone as 30990-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 30990-1-AP (RBM12 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30990-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 30990-1-AP (same clone as 30990-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using RBM12 antibody (30990-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 30990-1-PBS in a different storage buffer formulation.

RBM12 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30990-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

RNA-binding protein 12, RNA-binding motif protein 12, RNA binding protein 12, RNA binding motif protein 12, KIAA0765

---

Product Information

30990-1-PBS targets RBM12 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34621

  Product name: Recombinant human RBM12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 834-932 aa of BC013981

  Sequence: GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG

• Full Name: RNA binding motif protein 12
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC013981
• Gene Symbol: RBM12
• Gene ID (NCBI): 10137
• RRID: AB_3669810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NTZ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNA binding motif protein 12 (RBM12) is a member of the RBM family. RBM proteins are involved in RNA metabolism, including splicing, transport, translation and stability. RBM12 has been identified as a key protein that increases the expression of PD-L1, thereby promoting immune evasion in hepatocellular carcinoma (PMID: 39187545).