RBM12B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RBM12B Polyclonal antibody, PBS Only (17137-1-PBS)

• 

  WB analysis using 17137-1-AP (same clone as 17137-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17137-1-AP (RBM12B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17137-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17137-1-AP (same clone as 17137-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17137-1-AP (RBM12B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17137-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17137-1-AP (same clone as 17137-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17137-1-AP (RBM12B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17137-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 17137-1-AP (same clone as 17137-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using RBM12B antibody (17137-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17137-1-PBS in a different storage buffer formulation.

RBM12B Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17137-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

17137-1-PBS targets RBM12B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10894

  Product name: Recombinant human RBM12B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-355 aa of BC039260

  Sequence: TGLTIPDGGVHIIGGEIGEAFIIFATDEDARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYGSSINQDAGFHTNGTGHGNLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGSRFIEVMQGSEQQWIEFGGNAVKEGDVLRRFEEHSPPRGINDRHFRKRSHSKSPRRTRSRSPLGFYVHLKNLSLSIDERDLRNFFRGTDLTDEQIRFLYKDENRTRYAFVMFKTLKDYNTALSLHKTVLQYRPVHI

• Full Name: RNA binding motif protein 12B
• Calculated Molecular Weight: 765 aa, 87 kDa, 118 kDa
• Observed Molecular Weight: 118-130 kDa
• GenBank Accession Number: BC039260
• Gene Symbol: RBM12B
• Gene ID (NCBI): 389677
• RRID: AB_2175746
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXT5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.