RBM18 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RBM18 Polyclonal antibody (32924-1-AP)

• 

  WB analysis using 32924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32924-1-AP (RBM18 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

RBM18 Polyclonal Antibody for WB, ELISA

Cat No. 32924-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

Probable RNA-binding protein 18, RNA Binding Motif Protein 18 , RNA-binding motif protein 18

---

Tested Applications

• Positive WB detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32924-1-AP targets RBM18 in applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38618

  Product name: Recombinant human RBM18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of NM_033117.3

  Sequence: MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR*

• Full Name: RNA binding motif protein 18
• Calculated Molecular Weight: 22kDa，190aa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NM_033117.3
• Gene Symbol: RBM18
• Gene ID (NCBI): 92400
• RRID: AB_3742790
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96H35
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBM18 (RNA Binding Motif Protein 18) functions as an RNA-binding protein and plays roles in various biological processes, including mRNA processing, cell cycle regulation, and ribosome assembly. Additionally, RBM18 is involved in transcriptional regulation and signal transduction. In cancer research, the expression levels of RBM18 are associated with the invasive and metastatic capabilities of tumors. For instance, RBM18 may act as a tumor suppressor in certain types of cancer by regulating the expression of specific genes to inhibit tumor cell proliferation. Therefore, RBM18 is considered a potential tumor suppressor.