RBM25 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84968-4-RR (same clone as 84968-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84968-4-RR (RBM25 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84968-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84968-4-RR (same clone as 84968-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84968-4-RR (RBM25 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84968-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 84968-4-RR (same clone as 84968-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84968-4-RR (RBM25 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84968-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84968-4-RR (same clone as 84968-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RBM25 antibody (84968-4-RR, Clone: 242526B7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84968-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84968-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84968-4-RR against Human RBM25 were performed. The affinity constant is 2.38 nM.

RBM25 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84968-4-PBS

Clone No.242526B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

242526B7, Arg/Glu/Asp-rich protein of 120 kDa, NET52, Protein S164, RBM 25

---

Product Information

84968-4-PBS targets RBM25 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18244

  Product name: Recombinant human RBM25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 605-839 aa of BC113389

  Sequence: QKPCLKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK

• Full Name: RNA binding motif protein 25
• Calculated Molecular Weight: 843 aa, 100 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC113389
• Gene Symbol: RBM25
• Gene ID (NCBI): 58517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P49756
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNA-binding protein 25 (RBM25), also named as Protein S164 or RNPC7, is a 843 amino acid protein, which contains one RRM domain and one PWI domain. RBM25 localizes in the nucleus and cytoplasm. RBM25 acts as a regulator of alternative pre-mRNA splicing and is involved in apoptotic cell death through the regulation of the apoptotic factor BCL2L1 isoform expression.