RBM26 Recombinant monoclonal antibody

• 

  WB analysis using 86302-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86302-1-RR (RBM26 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86302-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RBM26 antibody (86302-1-RR, Clone: 250871F5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86302-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86302-1-RR against Human RBM26 were performed. The affinity constant is below 1 pM.

RBM26 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86302-1-RR

Clone No.250871F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

ARRS2, C13orf10, CTCL tumor antigen se70-2, PRO1777, RBM 26

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue, rat testis tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86302-1-RR targets RBM26 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10398

  Product name: Recombinant human RBM26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 751-1007 aa of BC000791

  Sequence: TQKMLISKLEKNKTMKSEDKAEIMKTLEVLTKNITKLKDEVKAASPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLEAAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFAQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNISAVETEEVEPDEEEFQEESLVDDSLLQDDDEEEEDNESRSWRR

• Full Name: RNA binding motif protein 26
• Calculated Molecular Weight: 983 aa, 111 kDa
• Observed Molecular Weight: 130-140 kDa
• GenBank Accession Number: BC000791
• Gene Symbol: RBM26
• Gene ID (NCBI): 64062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5T8P6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.