RBM39 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RBM39 Polyclonal antibody (21339-1-AP)

• Featured Product
• KD/KO Validated

RBM39 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21339-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, CoIP, RIP, ELISA

Synonyms

CAPER, CAPERalpha, CC1.3, fSAP59, HCC1

• 

  WB analysis of HEK-293T using 21339-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 21339-1-AP (RBM39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 21339-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21339-1-AP (RBM39 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 21339-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 21339-1-AP (RBM39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 21339-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 21339-1-AP (RBM39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 21339-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 21339-1-AP (RBM39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 21339-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 21339-1-AP (RBM39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 21339-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 21339-1-AP (RBM39 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 21339-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 21339-1-AP (RBM39 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 21339-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using 21339-1-AP (RBM39 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RBM39 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, human skeletal muscle tissue
• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21339-1-AP targets RBM39 in WB, IHC, IF/ICC, CoIP, RIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15584

  Product name: Recombinant human RBM39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 328-530 aa of BC141835

  Sequence: ERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR

• Full Name: RNA binding motif protein 39
• Calculated Molecular Weight: 530 aa, 59 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC141835
• Gene Symbol: RBM39
• Gene ID (NCBI): 9584
• RRID: AB_10733352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14498
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBM39, also named as HCC1 or RNPC2, is a 530 amino acid protein, which contains three RRM (RNA recognition motif) domains and belongs to the splicing factor SR family. RBM39 is widely expressed in various tissues and with highly expression in pancreas, skeletal muscle, lung and brain. RBM39 is a transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. RBM39 may be involved in pre-mRNA splicing process.

Publications

What published studies show

RBM39 Affinity Purification Antibody (Cat# 21339-1-AP) has 20 citations published in journals including Advanced Science, Cell Reports, PLoS Biology, Journal of Biological Chemistry, Haematologica, Acta Neuropathologica, Cell Death & Discovery, and FEBS Journal. Research fields span oncology (lung, liver, gastric, breast, colorectal, endometrial, and cholangiocarcinoma), RNA splicing and processing, neurodegenerative diseases (FTLD/ALS), metabolic dysfunction-associated steatotic liver disease, and HIV regulation.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Adv Sci (Weinh); Splicing Shift of RAC1 Accelerates Tumorigenesis and Defines a Potent Therapeutic Target in Lung Cancer; Authors - Yueren Yan
human	RIP,IHC	Cell Death Discov; The cancer-testis lncRNA LINC01977 promotes HCC progression by interacting with RBM39 to prevent Notch2 ubiquitination; Authors - Anliang Xia
human	WB	Acta Pharmacol Sin; RNA-binding motif protein RBM39 enhances the proliferation of gastric cancer cells by facilitating an oncogenic splicing switch in MRPL33; Authors - Cheng-Piao Lu
human	IHC	Acta Neuropathol; Transportin 1 accumulates specifically with FET proteins but no other transportin cargos in FTLD-FUS and is absent in FUS inclusions in ALS with FUS mutations.; Authors - Neumann Manuela M
human	IHC,IF	Cell Mol Gastroenterol Hepatol; RBM39 enhances cholangiocarcinoma growth through EZH2-mediated WNT7B/β-catenin pathway; Authors - Nianli Liu
human	WB	Haematologica; Hypoxia-induced long non-coding RNA DARS-AS1 regulates RBM39 stability to promote myeloma malignancy.; Authors - Jia Tong