Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells |
| Positive IHC detected in | human liver cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21896-1-AP targets RBM7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11106 Product name: Recombinant human RBM7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 5-266 aa of BC034381 Sequence: AAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH Predict reactive species |
| Full Name | RNA binding motif protein 7 |
| Calculated Molecular Weight | 266 aa, 31 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC034381 |
| Gene Symbol | RBM7 |
| Gene ID (NCBI) | 10179 |
| RRID | AB_2878938 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y580 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RBM7 (RNA-binding motif protein 7) is an RNA-binding protein initially described to associate with splicing factors, presumably to target intronic RNA for decay (PMID: 35688134). RBM7 regulates the nuclear degradation of NEAT1 non-coding RNA, resulting in sustained apoptosis in the lung epithelium and fibrosis (PMID: 32708315).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RBM7 antibody 21896-1-AP | Download protocol |
| IHC protocol for RBM7 antibody 21896-1-AP | Download protocol |
| WB protocol for RBM7 antibody 21896-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RBM7 Polyclonal antibody (Cat# 21896-1-AP) has 7 citations published in Cell, Nature Communications, Molecular Cell, Nucleic Acids Research, MedComm, and Molecular Genetics and Genomics. Research fields span RNA–protein interactions, transcription regulation, innate immune signaling, epigenetics (H3K27me3), esophageal tumorigenesis, glioblastoma, and ferroptosis. All cited applications are Western blot in human samples.
| Species | Application | Title |
|---|---|---|
Cell MYC binding to nascent RNA suppresses innate immune signaling by R-loop-derived RNA-DNA hybrids | ||
Mol Cell ARS2 instructs early transcription termination-coupled RNA decay by recruiting ZC3H4 to nascent transcripts | ||
Mol Cell P-TEFb Activation by RBM7 Shapes a Pro-survival Transcriptional Response to Genotoxic Stress. | ||
Nucleic Acids Res The NEXT complex regulates H3K27me3 levels to affect cancer progression by degrading G4/U-rich lncRNAs
| ||
MedComm (2020) FBXW7 Targets the SPT6-ΔNp63 Axis for Degradation to Inhibit Esophageal Tumorigenesis Induced by 4-Nitroquinoline N-Oxide. |
Reviews
What customers say
All four reviews are 5-star, focused on Western Blot applications. Users consistently report excellent specificity and reliable detection of RBM7 across multiple cell lines, including RKO, U2OS, HEK293T, and HeLa. Recommended dilutions range from 1:1000 to 1:3000, with overnight incubation at 4°C noted for HeLa extracts. Reviewers describe the antibody as "specific," "great," and note it "worked perfectly" for detecting the NEXT complex subunit RBM7. No negative feedback or issues were reported across any of the reviews.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Aleksandr (Verified Customer) (12-16-2024) | Specific antibody!
 |
Tsimafei (Verified Customer) (11-19-2024) | Great antibody that detect Rbm7 in U2OS cells
 |
Moritz (Verified Customer) (08-20-2024) | I used this antibody to detect RBM7 with Western blot in HEK293T WT cell lysate, which worked perfectly.
 |
Roy (Verified Customer) (06-15-2024) | Works well to detect the NEXT complex subunit RBM7 from HeLa extracts (1/1000 Dilution, overnight Incubation at 4°C).
|
