Use Able AI chat for product recommendations

RBP4 Recombinant monoclonal antibody, PBS Only (Capture)

RBP4 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 84496-1-PBS
Clone No.241944B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

241944B3, Plasma retinol binding protein, Plasma retinol-binding protein, Plasma retinol-binding protein(1-176), Plasma retinol-binding protein(1-179)

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84496-1-PBS targets RBP4 as part of a matched antibody pair:

MP01338-1: 84496-1-PBS capture and 84496-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg31642

Product name: Recombinant Human RBP4 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 19-201 aa of BC020633

Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Predict reactive species
Full Name retinol binding protein 4, plasma
Calculated Molecular Weight 201 aa, 23 kDa
Observed Molecular Weight20-21 kDa
GenBank Accession NumberBC020633
Gene Symbol RBP4
Gene ID (NCBI) 5950
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02753
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RBP4 (retinol-binding protein 4) is a carrier protein that transports vitamin A (retinol) from the liver to the peripheral tissues. Synthesized primarily by hepatocytes and adipocytes as a 21 kDa non-glycosylated protein, RBP4 is secreted into the circulation as a retinol-RBP4 complex. In plasma the RBP4-retinol complex is bound to transthyretin (TRR), which prevents prevent kidney filtration. Two truncated forms of RBP4, RBP4-L (truncated at Leu-183) and RBP4-LL (truncated at Leu-182 and Leu-183), exist by proteolytic process. RBP4-L and RBP4-LL, which do not bind TTR, are normally excreted into the urine but accumulate in the serum during renal failure. Urinary RBP4 has been reported as marker for glomerular disease. RBP4 also was identified as an adipokine that elevated in some INS-resistant states. Measurement of serum RBP4 could be used to assess the risk of INS resistance, type 2 diabetes, obesity, and cardiovascular disease. (18752671, 16034410)

Loading...
||
New chat

Able

正在加载,请稍候...