RBP4 Recombinant monoclonal antibody, PBS Only

• 

RBP4 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84496-3-PBS

Clone No.241944F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

Plasma retinol binding protein, Plasma retinol-binding protein, Plasma retinol-binding protein(1-176), Plasma retinol-binding protein(1-179), Plasma retinol-binding protein(1-181)

---

Product Information

84496-3-PBS targets RBP4 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31642

  Product name: Recombinant Human RBP4 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 19-201 aa of BC020633

  Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

• Full Name: retinol binding protein 4, plasma
• Calculated Molecular Weight: 201 aa, 23 kDa
• GenBank Accession Number: BC020633
• Gene Symbol: RBP4
• Gene ID (NCBI): 5950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02753
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.