Mouse RBP4 Recombinant monoclonal antibody, PBS Only

RBP4 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 84503-4-PBS
Clone No.242040D6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

242040D6, Plasma retinol-binding protein, PRBP, RBP, Retinol-binding protein 4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84503-4-PBS targets RBP4 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1140

Product name: Recombinant Mouse RBP4 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-201 aa of NM_011255.3

Sequence: ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Predict reactive species
Full Name retinol binding protein 4, plasma
Calculated Molecular Weight23kDa
Observed Molecular Weight20-23 kDa
GenBank Accession NumberNM_011255.3
Gene Symbol Rbp4
Gene ID (NCBI) 19662
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ00724
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RBP4 (retinol-binding protein 4) is a carrier protein that transports vitamin A (retinol) from the liver to the peripheral tissues. Synthesized primarily by hepatocytes and adipocytes as a 21 kDa non-glycosylated protein, RBP4 is secreted into the circulation as a retinol-RBP4 complex. In plasma the RBP4-retinol complex is bound to transthyretin (TRR), which prevents prevent kidney filtration. Two truncated forms of RBP4, RBP4-L (truncated at Leu-183) and RBP4-LL (truncated at Leu-182 and Leu-183), exist by proteolytic process. RBP4-L and RBP4-LL, which do not bind TTR, are normally excreted into the urine but accumulate in the serum during renal failure. Urinary RBP4 has been reported as marker for glomerular disease. RBP4 also was identified as an adipokine that elevated in some INS-resistant states. Measurement of serum RBP4 could be used to assess the risk of INS resistance, type 2 diabetes, obesity, and cardiovascular disease. (18752671, 16034410)

Loading...
||
New chat Able
正在加载,请稍候...