RBP5 Monoclonal antibody, PBS Only

RBP5 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68126-1-PBS
Clone No.1G7E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig

Applications

WB, IF/ICC, Indirect ELISA

CRBP III, CRBP3, CRBPIII, HRBPiso, RBP5, Retinol binding protein 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68126-1-PBS targets RBP5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, pig samples.

Tested Reactivity Human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24562

Product name: Recombinant human RBP5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-135 aa of BC029355

Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

Predict reactive species
Full Name retinol binding protein 5, cellular
Calculated Molecular Weight 135 aa, 16 kDa
Observed Molecular Weight 16-18 kDa
GenBank Accession NumberBC029355
Gene Symbol RBP5
Gene ID (NCBI) 83758
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP82980
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RBP5 (CRBP III) belongs to the fatty-acid binding protein (FABP) family. Human liver and kidney contain the highest levels of CRBP III mRNA, and CRBP III is as a major human intracellular carrier of retinol (PMID:11274389). RBP5 iron response are reversible by genetic complementation. And increased RBP5 expression occurs by a post-transcriptional feedback mechanism whereby RBP5 interacts with its own, and with PAP2 mRNAs. RBP5 is the most significant of the proteins upregulated by iron starvation (PMID:34161395). RBP5 has an estimated molecular mass (15.9 kDa) typical of this protein superfamily (PMID:11274389).

Loading...
||
New chat Able
正在加载,请稍候...