RBP5 Monoclonal antibody, PBS Only

• 

  WB analysis of pig kidney using 68126-1-Ig (same clone as 68126-1-PBS)

  pig kidney tissue were subjected to SDS PAGE followed by western blot with 68126-1-Ig (RBP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68126-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 68126-1-Ig (same clone as 68126-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 68126-1-Ig (RBP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68126-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68126-1-Ig (same clone as 68126-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68126-1-Ig (RBP5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68126-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68126-1-Ig (same clone as 68126-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using RBP5 antibody (68126-1-Ig, Clone: 1G7E2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68126-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 68126-1-Ig (same clone as 68126-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using RBP5 antibody (68126-1-Ig, Clone: 1G7E2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68126-1-PBS in a different storage buffer formulation.

RBP5 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68126-1-PBS

Clone No.1G7E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CRBP III, CRBP3, CRBPIII, HRBPiso, RBP5, Retinol binding protein 5

---

Product Information

68126-1-PBS targets RBP5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, pig samples.

• Tested Reactivity: Human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24562

  Product name: Recombinant human RBP5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-135 aa of BC029355

  Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

• Full Name: retinol binding protein 5, cellular
• Calculated Molecular Weight: 135 aa, 16 kDa
• Observed Molecular Weight: 16-18 kDa
• GenBank Accession Number: BC029355
• Gene Symbol: RBP5
• Gene ID (NCBI): 83758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P82980
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBP5 (CRBP III) belongs to the fatty-acid binding protein (FABP) family. Human liver and kidney contain the highest levels of CRBP III mRNA, and CRBP III is as a major human intracellular carrier of retinol (PMID:11274389). RBP5 iron response are reversible by genetic complementation. And increased RBP5 expression occurs by a post-transcriptional feedback mechanism whereby RBP5 interacts with its own, and with PAP2 mRNAs. RBP5 is the most significant of the proteins upregulated by iron starvation (PMID:34161395). RBP5 has an estimated molecular mass (15.9 kDa) typical of this protein superfamily (PMID:11274389).