Calcipressin 1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Calcipressin 1 Polyclonal antibody (14869-1-AP)

• Featured Product
• KD/KO Validated

Calcipressin 1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 14869-1-AP Copied!

Publications (5)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IP, ELISA

Synonyms

ADAPT78, Calcipressin 1, CSP1, DSC1, DSCR1, MCIP1, RCAN1, RCN1, regulator of calcineurin 1

• 

  WB analysis using 14869-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (Calcipressin 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 cells using 14869-1-AP

  WB result of RCAN1 antibody (14869-1-AP, 1:1000) with si-control and si-RCAN1 transfected SKOV-3 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 using 14869-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 14869-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 14869-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse cerebellum using 14869-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 14869-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 14869-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 14869-1-AP

  IP result of anti-Calcipressin 1 (IP:14869-1-AP, 4ug; Detection:14869-1-AP 1:500) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14869-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14869-1-AP (RCAN1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14869-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14869-1-AP (RCAN1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Calcipressin 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, SKOV-3 cells, human heart tissue, mouse skeletal muscle tissue, mouse heart tissue, A431 cells, mouse cerebellum tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14869-1-AP targets Calcipressin 1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6457

  Product name: Recombinant human RCAN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-197 aa of BC002864

  Sequence: MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS

• Full Name: regulator of calcineurin 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 25-29 kDa
• GenBank Accession Number: BC002864
• Gene Symbol: RCAN1
• Gene ID (NCBI): 1827
• RRID: AB_10640904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53805
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Calcipressin 1 (RCAN1) polyclonal antibody (Cat# 14869-1-AP) has 5 total citations, all for Western blot. Citations appear in Free Radic Biol Med, Biol Sex Differ, Biomed Mater, Front Med (Lausanne), and Animals (Basel). Research fields span ferroptosis and diabetic cardiomyopathy, Alzheimer's disease proteomics, chondrogenesis, osteoarthritis epigenomics, and cAMP-mediated spermatogenesis. Cited species include human, mouse, rat, and sheep.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Free Radic Biol Med; N6-methyladenosine modification of SPOP relieves ferroptosis and diabetic cardiomyopathy by enhancing ubiquitination of VDAC3; Authors - Wei Meng
mouse	WB	Biol Sex Differ; Mapping the hippocampal spatial proteomic signature in male and female mice of an early Alzheimer's disease model; Authors - Ana Contreras
rat	WB	Biomed Mater; Dynamic stiffness drives BMSC chondrogenesis viaIhh-regulated H3K18 lactylation/Rcan1axis and mitochondrial fission remodeling.; Authors - Liyang Chen
human	WB	Front Med (Lausanne); The identification of hub-methylated differentially expressed genes in osteoarthritis patients is based on epigenomic and transcriptomic data; Authors - Zhen-Chen Chu
sheep	WB	Animals (Basel); DIA Proteomics Reveals the Mechanism of cAMP Signaling Pathway-Mediated HPT Axis in Regulating Spermatogenesis of Hu Sheep.; Authors - Lina Zhu

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The single review rates the product 4 out of 5 stars for Western Blot. The user reported using a 1:1500 dilution on mouse brain tissue and observed a clear band, with a stronger signal in Ts65Dn mice attributed to gene dosage effects. Overall, the feedback indicates reliable performance for detecting the target in mouse brain samples.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Xu (Verified Customer) (10-06-2020)

It can produce a clear band in mouse brain with a stronger one in Ts65Dn mouse due to gene dose.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1500
• Cell Tissue Type: mouse brain

Calcipressin 1 Antibody Western Blot validation (1:1500 dilution) in mouse brain (Cat no:14869-1-AP)