RCAN2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86561-1-RR (same clone as 86561-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86561-1-RR (RCAN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86561-1-PBS in a different storage buffer formulation.

RCAN2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86561-1-PBS

Clone No.251381D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

Calcipressin 2, Calcipressin-2, CSP2, Down syndrome candidate region 1-like 1, DSCR1L1

---

Product Information

86561-1-PBS targets RCAN2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3597

  Product name: Recombinant human RCAN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-201 aa of BC038509

  Sequence: LFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAAC

• Full Name: regulator of calcineurin 2
• Calculated Molecular Weight: 225 aa, 25 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC038509
• Gene Symbol: RCAN2
• Gene ID (NCBI): 10231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14206
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.