CoraLite® Plus 488-conjugated RCAS1 Monoclonal antibody

RCAS1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66170
Clone No.4H8A12

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

EBAG9, Estrogen receptor-binding fragment-associated gene 9 protein, EBAG 9, EB9, Cancer-associated surface antigen RCAS1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66170 targets RCAS1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2905

Product name: Recombinant human EBAG9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-213 aa of BC017729

Sequence: MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Predict reactive species
Full Name estrogen receptor binding site associated, antigen, 9
Calculated Molecular Weight 213 aa, 24 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC017729
Gene Symbol RCAS1
Gene ID (NCBI) 9166
RRIDAB_3084216
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO00559
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Estrogen receptor-binding fragment-associated antigen 9 (EBAG9) gene was identified as an estrogen-responsive gene. The gene product, receptor-binding cancer antigen expressed on SiSo cells (RCAS1), is associated with aggressive characteristics and poor overall survival for 15 different human malignancies. The correlation between RCAS1 expression and several clinicopathological variables, including tumor size, clinical stage, invasion depth and lymph node metastasis highlights this molecule's clinical significance. Expression of RCAS1 in tumor cells plays an important role in evasion from host immune system resulting tumor progression, invasion and metastasis. Further exploration of RCAS1 biological function will facilitate development of novel therapeutic strategies that target RCAS1.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RCAS1 antibody CL488-66170Download protocol
FC protocol for CL Plus 488 RCAS1 antibody CL488-66170Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...