RCN1 Polyclonal antibody

• 

RCN1 Polyclonal Antibody for ELISA

Cat No. 18412-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

PIG20, RCAL, RCN, RCN1, Reticulocalbin 1

---

Product Information

18412-1-AP targets RCN1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13256

  Product name: Recombinant human RCN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-272 aa of BC010120

  Sequence: MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHW

• Full Name: reticulocalbin 1, EF-hand calcium binding domain
• Calculated Molecular Weight: 39 kDa
• GenBank Accession Number: BC010120
• Gene Symbol: RCN1
• Gene ID (NCBI): 5954
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15293
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.