Tested Applications
| Positive WB detected in | C2C12 cell, PC-12 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27686-1-AP targets RCOR1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26770 Product name: Recombinant human RCOR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 245-310 aa of NM_015156 Sequence: MRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKP Predict reactive species |
| Full Name | REST corepressor 1 |
| Calculated Molecular Weight | 53 kDa |
| Observed Molecular Weight | 60-65 kDa |
| GenBank Accession Number | NM_015156 |
| Gene Symbol | RCOR1 |
| Gene ID (NCBI) | 23186 |
| RRID | AB_2880947 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UKL0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RCOR1, also named as REST corepressor 1, is a 485 amino acid protein, which belongs to the CoREST family. RCOR1 is a essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. The calculated molecular weight of RCOR1 is a 53 kDa, but the phosphorylated RCOR1 is about 60-65 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RCOR1 antibody 27686-1-AP | Download protocol |
| WB protocol for RCOR1 antibody 27686-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
RCOR1 Polyclonal antibody (Cat# 27686-1-AP) has 10 citations published in Signal Transduction and Targeted Therapy, Nature Communications, Cell Chemical Biology, EMBO Journal, Cell Reports, Journal of Biological Chemistry, Journal of Virology, Biochemical and Biophysical Research Communications, and Annals of Diagnostic Pathology. Associated research fields include cancer biology, epigenetics, intestinal stem cell biology, neurology, virology, and Wnt/β-catenin signaling.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther The noncanonical function of liver-type phosphofructokinase potentiates the efficacy of HDAC inhibitors in cancer. | ||
Nat Commun Demethylase-independent roles of LSD1 in regulating enhancers and cell fate transition
| ||
Nat Commun Phytic acid (InsP(6)) activates HDAC3 epigenetic axis to maintain intestinal barrier function. | ||
Cell Chem Biol HDAC3 and HDAC8 PROTAC dual degrader reveals roles of histone acetylation in gene regulation | ||
Cell Rep E3 ligase Trim35 inhibits LSD1 demethylase activity through K63-linked ubiquitination and enhances anti-tumor immunity in NSCLC |
