RCOR1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RCOR1 Recombinant monoclonal antibody (86954-1-RR)

• 

  WB analysis using 86954-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86954-1-RR (RCOR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86954-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RCOR1 antibody (86954-1-RR, Clone: 252115G9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86954-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86954-1-RR against Human RCOR1 were performed. The affinity constant is 1.20 nM.

RCOR1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86954-1-RR

Clone No.252115G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

COREST, RCOR, RCOR 1

---

Tested Applications

• Positive WB detected in: K-562 cells, MOLT-4 cells, Neuro-2a cells, C6 cells, PC-12 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86954-1-RR targets RCOR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26770

  Product name: Recombinant human RCOR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 245-310 aa of NM_015156

  Sequence: MRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKP

• Full Name: REST corepressor 1
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_015156
• Gene Symbol: RCOR1
• Gene ID (NCBI): 23186
• RRID: AB_3745231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UKL0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RCOR1, also named as REST corepressor 1, is a 485 amino acid protein, which belongs to the CoREST family. RCOR1 is a essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. The calculated molecular weight of RCOR1 is a 53 kDa, but the phosphorylated RCOR1 is about 60-65 kDa.