RCOR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RCOR2 Polyclonal antibody, PBS Only (23969-1-PBS)

• 

  WB analysis of Jurkat using 23969-1-AP (same clone as 23969-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 23969-1-AP (RCOR2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23969-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 23969-1-AP (same clone as 23969-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23969-1-AP (RCOR2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 23969-1-AP (same clone as 23969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23969-1-AP (RCOR2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 23969-1-AP (same clone as 23969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23969-1-AP (RCOR2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 23969-1-AP (same clone as 23969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23969-1-AP (RCOR2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23969-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RCOR2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23969-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

23969-1-PBS targets RCOR2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21112

  Product name: Recombinant human RCOR2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 175-523 aa of BC023587

  Sequence: SWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPADPKREPLPSRPLNARPGPGKKEVQVSQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQVQSMKQTNSSLRQALEGGIDPLRPPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAPGAPVPMEEARRGAPLPAPALEEDDEVQITSVSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLIRPALAAPRHSARPGPQPPPTLIGAPLEPPAPSL

• Full Name: REST corepressor 2
• Calculated Molecular Weight: 523 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC023587
• Gene Symbol: RCOR2
• Gene ID (NCBI): 283248
• RRID: AB_2879382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8IZ40
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

In mammals, the CoREST (corepressor for element-1-silencing transcription factor) complex is a chromatin-modifying structure that, through interactions with NRSF (neuron restrictive silencer factor), regulates neuronal gene expression and neuronal cell fate. RCOR2 (REST corepressor 2) and RCOR3 (REST corepressor 3) are nuclear proteins that each contain one ELM2 domain and two SANT domains. RCOR2 and RCOR3, both members of the CoREST family, are thought to function as components of the CoREST complex, possibly playing a role in the transcriptional repression of neuronal genes. Additionally, RCOR2 and RCOR3, in conjunction with CoREST, can form immunocomplexes with a variety of histone-modifying genes, including G9a and HDAC1. Via these protein complexes, RCOR2 and RCOR3 can further regulate transcription by controlling the methylation and demethylation of target genes during early development.