RCOR3 Polyclonal antibody

• 

  WB analysis of mouse brain using 25970-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25970-1-AP (RCOR3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 25970-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25970-1-AP (RCOR3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

RCOR3 Polyclonal Antibody for WB, ELISA

Cat No. 25970-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KIAA1343, RCOR3, REST corepressor 3, RP11 318L16.1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25970-1-AP targets RCOR3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23055

  Product name: Recombinant human RCOR3 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 200-436 aa of BC031608

  Sequence: RQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAKKEGNTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANTILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQGTDPTGSSDTGSITSCPIIHSNTNSPYCHSEPASTTSSSNTACCPGSSPAASSTPAAGSVHPAPANFKSASTTSYSPC

• Full Name: REST corepressor 3
• Calculated Molecular Weight: 436aa,48 kDa; 495aa,56 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC031608
• Gene Symbol: RCOR3
• Gene ID (NCBI): 55758
• RRID: AB_2880314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2K3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.