RDH11 Polyclonal antibody

• 

  IHC staining of human prostate cancer using 11077-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11077-1-AP (RDH11 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 11077-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11077-1-AP (RDH11 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HaCaT using 11077-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using RDH11 antibody (11077-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

RDH11 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 11077-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

Prostate short-chain dehydrogenase/reductase 1, HCV core-binding protein HCBP12, EC:1.1.1.300, CGI-82, ARSDR1

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11077-1-AP targets RDH11 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1485

  Product name: Recombinant human RDH11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 67-318 aa of BC011727

  Sequence: RVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID

• Full Name: retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC011727
• Gene Symbol: RDH11
• Gene ID (NCBI): 51109
• RRID: AB_2177870
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TC12
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RDH11(Retinol dehydrogenase 11) is also named as ARSDR1(androgen-regulated short-chain dehydrogenase/reductase 1 ), PSDR1(prostate short-chain dehydrogenase/reductase 1) and belongs to the short-chain dehydrogenases/reductases (SDR) family. RDH11 is involved in steroid synthesis and/or degradation in normal and neoplastic prostate epithelium, and, as such, it may be a key enzyme involved in maintaining intracellular balance of steroid hormones in these cells(PMID:11245473). The deduced protein contains 318 amino acids, and the transcript contains 2 potential polyadenylation signals. It has 2 isoforms produced by alternative splicing.