RDH11 Polyclonal antibody

RDH11 Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 11077-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Prostate short-chain dehydrogenase/reductase 1, HCV core-binding protein HCBP12, EC:1.1.1.300, CGI-82, ARSDR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHaCaT cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11077-1-AP targets RDH11 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1485

Product name: Recombinant human RDH11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 67-318 aa of BC011727

Sequence: RVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID

Predict reactive species
Full Name retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC011727
Gene Symbol RDH11
Gene ID (NCBI) 51109
RRIDAB_2177870
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TC12
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RDH11(Retinol dehydrogenase 11) is also named as ARSDR1(androgen-regulated short-chain dehydrogenase/reductase 1 ), PSDR1(prostate short-chain dehydrogenase/reductase 1) and belongs to the short-chain dehydrogenases/reductases (SDR) family. RDH11 is involved in steroid synthesis and/or degradation in normal and neoplastic prostate epithelium, and, as such, it may be a key enzyme involved in maintaining intracellular balance of steroid hormones in these cells(PMID:11245473). The deduced protein contains 318 amino acids, and the transcript contains 2 potential polyadenylation signals. It has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for RDH11 antibody 11077-1-APDownload protocol
IHC protocol for RDH11 antibody 11077-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...