RDM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RDM1 Polyclonal antibody (20156-1-AP)

• Featured Product
• KD/KO Validated

RDM1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20156-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RAD52 homolog B, RAD52 motif 1, RAD52B, RDM1

• 

  WB analysis of PC-3 using 20156-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 20156-1-AP (RDM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 20156-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 20156-1-AP (RDM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 20156-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 20156-1-AP (RDM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 20156-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20156-1-AP (RDM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 20156-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 20156-1-AP (RDM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 20156-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 20156-1-AP (RDM1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 20156-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20156-1-AP (RDM1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 20156-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 20156-1-AP (RDM1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 20156-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20156-1-AP (RDM1 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 20156-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed PC-3 cells using 20156-1-AP (RDM1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RDM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells, human placenta tissue, MCF-7 cells
• Positive IHC detected in: human lung tissue, human brain tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20156-1-AP targets RDM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14077

  Product name: Recombinant human RDM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-253 aa of BC038301

  Sequence: QHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD

• Full Name: RAD52 motif 1
• Calculated Molecular Weight: 284 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC038301
• Gene Symbol: RDM1
• Gene ID (NCBI): 201299
• RRID: AB_10666433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NG50
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RDM1, also named as RAD52B, encodes a RNA recognition motif (RRM)-containing protein confered resistance to the antitumor agent cisplatin. The expression of RDM1 is closely related to the cell proliferation and apoptosis of thyroid carcinoma cells and RDM1 may be a potential marker of lung adenocarcinoma. RDM1 has many isoforms (8 kDa, 12-19 kDa and 25-32 kDa) with long or short N-terminus and a great diversity in the exonic composition of C-terminus generated by alternative pre-mRNA splicing and differential usage of two translational start sites. RDM1 protein can be expressed differently in cytoplasm or nuclear/nucleolar in the absence of stress, proteotoxic stress and mild heat shock, suggesting functional differences among the RDM1 proteins. ( PMID: 28939762, 17905820, 28939762, 30069034)

Publications

What published studies show

The anti-RDM1 antibody (Cat# 20156-1-AP) has 7 total citations. These appear in Artificial Cells, Nanomedicine, and Biotechnology, Frontiers in Cell and Developmental Biology, Scientific Reports (×2), Journal of Cellular and Molecular Medicine, Molecular Oncology, and FEBS Open Biology. The research fields span oncology, covering ovarian carcinoma, glioma survival prediction, clear cell renal cell carcinoma, lung adenocarcinoma, breast cancer, hepatocellular carcinoma, and neuroblastoma, with applications primarily in WB and IHC.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Artif Cells Nanomed Biotechnol; RDM1 plays an oncogenic role in human ovarian carcinoma cells.; Authors - Lu Tong ; KD Validated
human	WB	Front Cell Dev Biol; A Novel Signature Constructed by RNA-Binding Protein Coding Genes to Improve Overall Survival Prediction of Glioma Patients.; Authors - Zewei Tu
human	WB,IHC	Sci Rep; RDM1 plays an oncogenic role in human lung adenocarcinoma cells.; Authors - Lu Tong ; KD Validated
human	WB	Sci Rep; RDM1 plays an oncogenic role in clear cell renal cell carcinoma potentially by modulating MCM2.; Authors - Xiuming Li ; KD Validated
human	WB	J Cell Mol Med; RDM1 promotes critical processes in breast cancer tumorigenesis.; Authors - Yajun Chen ; KD Validated
human	WB,IHC,IF	Mol Oncol; Loss of RDM1 enhances hepatocellular carcinoma progression via p53 and Ras/Raf/ERK pathways.; Authors - Shi-Lu Chen ; KD Validated