Radixin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Radixin Polyclonal antibody (26105-1-AP)

Radixin Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26105-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IF/ICC, ELISA

Synonyms

RDX

• 

  WB analysis using 26105-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26105-1-AP (RDX antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 26105-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26105-1-AP (RDX Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 26105-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26105-1-AP (RDX Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 26105-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26105-1-AP (RDX Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 26105-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 26105-1-AP (RDX antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: COS-7 cells, HeLa cells, Jurkat cells, mouse liver tissue, C6 cells, mouse brain tissue, mouse lung tissue, rat brain tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26105-1-AP targets Radixin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23532

  Product name: Recombinant human RDX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 384-455 aa of BC047109

  Sequence: EEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQED

• Full Name: radixin
• Calculated Molecular Weight: 583 aa, 68 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC047109
• Gene Symbol: RDX
• Gene ID (NCBI): 5962
• RRID: AB_2880380
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35241
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Radixin belongs to the ezrin-radixin-moesin (ERM) family of proteins which act as cross-linkers between membrane and actin cytoskeleton. ERM proteins provide structural links to strengthen the cell cortex and facilitate several key cellular processes, including membrane dynamics, substrate adhesion, cell survival, cell adhesion, and motility. The function of ERM proteins is highly reliant on phosphorylation induced conformational changes in response to chemokine and antigen stimulation.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Dev Cell; Generation of germinal-vesicle oocytes from mouse embryonic stem cells under an ovarian soma-free condition; Authors - Yoshiaki Nosaka