REEP1 Polyclonal antibody

• 

  WB analysis using 17988-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 17988-1-AP (REEP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 17988-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17988-1-AP (REEP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 17988-1-AP

  IP result of anti-REEP1 (IP:17988-1-AP, 3ug; Detection:17988-1-AP 1:500) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of mouse brain using 17988-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17988-1-AP (REEP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 17988-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17988-1-AP (REEP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

REEP1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 17988-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

C2orf23, receptor accessory protein 1, REEP1, SPG31

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IF: See 1 publications below
• IP: See 2 publications below

Product Information

17988-1-AP targets REEP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12418

  Product name: Recombinant human REEP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-201 aa of BC064846

  Sequence: IAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA

• Full Name: receptor accessory protein 1
• Calculated Molecular Weight: 201 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC064846
• Gene Symbol: REEP1
• Gene ID (NCBI): 65055
• RRID: AB_2178441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H902
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Struct Mol Biol; Aurora kinase A-mediated phosphorylation triggers structural alteration of Rab1A to enhance ER complexity during mitosis; Authors - Wei Zhang
human,mouse	WB	Cell Res; DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.; Authors - Pengli Zheng
	IP	Mol Psychiatry; Dysfunctional tubular endoplasmic reticulum constitutes a pathological feature of Alzheimer's disease.; Authors - M G Sharoar
human	WB	Autophagy; DIPK2A promotes STX17- and VAMP7-mediated autophagosome-lysosome fusion by binding to VAMP7B.; Authors - Xiaoyu Tian
mouse	WB,IF	Hum Mol Genet; Reep1 null mice reveal a converging role for hereditary spastic paraplegia proteins in lipid droplet regulation.; Authors - Benoît Renvoisé ; KO Validated
human	WB	Neurobiol Dis; Disease-causing mutated ATLASTIN 3 is excluded from distal axons and reduces axonal autophagy.; Authors - Laura Behrendt