REG1B Polyclonal antibody

• 

  WB analysis of PC-3 using 13519-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13519-1-AP (REG1B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

REG1B Polyclonal Antibody for WB, ELISA

Cat No. 13519-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Lithostathine 1 beta, Pancreatic stone protein 2, PSP 2, PSPS2, REG 1 beta, REG1B, Regenerating protein I beta, REGH, REGI BETA, REGL

---

Product Information

13519-1-AP targets REG1B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4117

  Product name: Recombinant human REG1B protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-166 aa of BC027895

  Sequence: MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

• Full Name: regenerating islet-derived 1 beta
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC027895
• Gene Symbol: REG1B
• Gene ID (NCBI): 5968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48304
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.