REG4 Polyclonal antibody, PBS Only

• 

  WB analysis of SGC-7901 using 12268-1-AP (same clone as 12268-1-PBS)

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 12268-1-AP (REG4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12268-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 12268-1-AP (same clone as 12268-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12268-1-AP (REG4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12268-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12268-1-AP (same clone as 12268-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12268-1-AP (REG4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 12268-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12268-1-AP (same clone as 12268-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12268-1-AP (REG4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 12268-1-PBS in a different storage buffer formulation.

REG4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12268-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

GISP, REG 4, Reg IV, REG like protein, REG-4

---

Product Information

12268-1-PBS targets REG4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2934

  Product name: Recombinant human REG4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-158 aa of BC017089

  Sequence: VLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

• Full Name: regenerating islet-derived family, member 4
• Calculated Molecular Weight: 158 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC017089
• Gene Symbol: REG4
• Gene ID (NCBI): 83998
• RRID: AB_2178702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYZ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

REG4 (Regenerating islet-derived protein 4) is a secreted C-type lectin that belongs to the regenerating gene (REG) family. Initially identified in a cDNA library from ulcerative colitis tissue, REG4 is predominantly expressed by intestinal enteroendocrine cells and is markedly up-regulated during gut inflammation and in various gastrointestinal cancers.