Renin receptor, ATP6AP2 Polyclonal antibody

Renin receptor, ATP6AP2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 10926-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

ATP6AP2, Renin receptor, APT6M8 9, ATPase H(+)-transporting lysosomal accessory protein 2, ATP6M8-9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human retinal pigment epithelium tissue, rat brain tissue
Positive IHC detected inmouse cerebellum tissue, human heart tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10926-1-AP targets Renin receptor, ATP6AP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1360

Product name: Recombinant human RENIN-RECEPTOR,ATP6AP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-99 aa of BC010395

Sequence: MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQANPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Predict reactive species
Full Name ATPase, H+ transporting, lysosomal accessory protein 2
Calculated Molecular Weight 39 kDa
Observed Molecular Weight28 kDa
GenBank Accession NumberBC010395
Gene Symbol Renin receptor
Gene ID (NCBI) 10159
RRIDAB_2062201
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75787
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP6AP2, also named as ATP6IP2, CAPER, ELDF10, N14F, ATP6M8-9, Renin receptor, and prorenin receptor, is believed to potentiate the renin-angiotensin system (RAS), conferring to prorenin, a likely pathological role at the tissue level. The PRR has been identified in the microvascular endothelial cells of the retina, which seems to be involved in pathological neovascularization processes. The present study demonstrates for the first time that the PRR is expressed in human ATP6AP2 and suggests a molecular mechanism by which hypertension may exacerbate the pathology of dry AMD. ATP6AP2 functions as a renin and prorenin cellular receptor. It may mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS). Defects in ATP6AP2 are a cause of mental retardation X-linked with epilepsy (MRXE). The full length of ATP6AP2 protein is 39 kDa, and the band with an apparent molecular weight of 28 kDa is the soluble form.(PMID:19580809; PMID:28215051; PMID:34534267; PMID: 29127204)

Protocols

Product Specific Protocols
IF protocol for Renin receptor, ATP6AP2 antibody 10926-1-APDownload protocol
IHC protocol for Renin receptor, ATP6AP2 antibody 10926-1-APDownload protocol
WB protocol for Renin receptor, ATP6AP2 antibody 10926-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Clin Invest

mTORC1 feedback to AKT modulates lysosomal biogenesis through MiT/TFE regulation.

Authors - Kaushal Asrani
humanWB,IHC

Exp Eye Res

(Pro)renin receptor is expressed in human retinal pigment epithelium and participates in extracellular matrix remodeling.

Authors - Alcazar Oscar O
humanWB

Int J Clin Exp Pathol

MicroRNA-140-3p inhibits proliferation, migration and invasion of lung cancer cells by targeting ATP6AP2.

Authors - Xiao-Mei Kong
mouseWB,IHC

Placenta

Endothelin-1 production via placental (pro)renin receptor in a mouse model of preeclampsia

Authors - Sakurako Mishima
mouseWB

ACS Nano

Acidic Nanoparticles Restore Lysosomal Acidification and Rescue Metabolic Dysfunction in Pancreatic β-Cells under Lipotoxic Conditions

Authors - Chih Hung Lo
humanWB,IHC

Cell Biosci

PABPN1 regulates mRNA alternative polyadenylation to inhibit bladder cancer progression

Authors - Liang Chen
Loading...
||
New chat Able
正在加载,请稍候...