Renin receptor,ATP6AP2 Monoclonal antibody

Renin receptor,ATP6AP2 Monoclonal Antibody for ELISA
Cat No. 60017-1-Ig
Clone No.5H2E8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

ELISA

APT6M8 9, ATP6AP2, ATP6IP2, ATP6M8 9, CAPER, ELDF10, HT028, M8 9, MRXE, MSTP009, N14F, PRR, PSEC0072, Renin receptor, RENIN RECEPTOR,ATP6AP2, Renin/prorenin receptor, V ATPase M8.9 subunit, XMRE

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60017-1-Ig targets Renin receptor,ATP6AP2 in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1360

Product name: Recombinant human RENIN-RECEPTOR,ATP6AP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-99 aa of BC010395

Sequence: MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQANPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Predict reactive species
Full Name ATPase, H+ transporting, lysosomal accessory protein 2
Calculated Molecular Weight 39 kDa
GenBank Accession NumberBC010395
Gene Symbol Renin receptor
Gene ID (NCBI) 10159
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75787
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP6AP2, also named as ATP6IP2, CAPER, ELDF10, N14F, ATP6M8-9, Renin receptor and prorenin receptor, is believed to potentiate the renin-angiotensin system (RAS), conferring to prorenin, a likely pathological role at tissue level. The PRR has been identified in the microvascular endothelial cells of the retina, in which it seems to be involved in pathological neovascularization processes. The present study demonstrates for the first time that the PRR is expressed in human ATP6AP2 and suggests a molecular mechanism by which hypertension may exacerbate the pathology of dry AMD. ATP6AP2 functions as a renin and prorenin cellular receptor. It may mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS). Defects in ATP6AP2 are a cause of mental retardation X-linked with epilepsy (MRXE). (PMID:19580809)

Loading...
||
New chat

Able

正在加载,请稍候...