Tested Applications
| Positive IHC detected in | human lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18170-1-AP targets Resistin in IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12822 Product name: Recombinant human RETN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-108 aa of BC101560 Sequence: EAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP Predict reactive species |
| Full Name | resistin |
| Calculated Molecular Weight | 108 aa, 11 kDa |
| GenBank Accession Number | BC101560 |
| Gene Symbol | RETN |
| Gene ID (NCBI) | 56729 |
| RRID | AB_2918058 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HD89 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Resistin is a member of the resistin-like molecule family (RELMs) that includes three additional proteins, RELM-α, RELM-β, RELM-y . Resistin is almost exclusively expressed in white adipocytes in mice, whereas macrophages are the primary source in humans . In a variety of pathophysiologic states, particularly in type 2 diabetes mellitus and in chronic kidney disease, the serum concentration of resistin is increased. (PMID: 32822824, PMID: 19708984)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Resistin antibody 18170-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Resistin Polyclonal antibody (Cat# 18170-1-AP) has 3 total citations. These appear in Cell Reports in Medicine, PLoS Genetics, and Frontiers in Medicine (Lausanne). The associated research fields include chordoma classification and precision treatment, single-cell RNA profiling of mononuclear phagocytes in colorectal cancer, and resistin expression in interstitial lung disease associated with dermatomyositis.
| Species | Application | Title |
|---|---|---|
Cell Rep Med Clinical-proteomic classification and precision treatment strategy of chordoma | ||
PLoS Genet Single-cell RNA profiling reveals classification and characteristics of mononuclear phagocytes in colorectal cancer | ||
Front Med (Lausanne) Resistin Expression Is Associated With Interstitial Lung Disease in Dermatomyositis. |
Reviews
What customers say
One user reviewed this antibody with a 5-star rating. They used it for Western Blot and Immunofluorescence at a 1:100 dilution (lot 00074226) and noted it performed well for IF. Overall, the feedback is positive, highlighting its suitability for immunofluorescence applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-26-2025) | good for IF
|
