RETNLB Polyclonal antibody

• 

  IHC staining of human small intestine using 18232-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 18232-1-AP (RETNLB antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human small intestine using 18232-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 18232-1-AP (RETNLB antibody) at dilution of 1:200 (under 40x lens).

RETNLB Polyclonal Antibody for IHC, ELISA

Cat No. 18232-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

CCRG, FIZZ1, FIZZ2, HXCP2, RELM beta, RELMb, RELMbeta, resistin like beta, RETNL2, RETNLB, XCP2

---

Tested Applications

• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18232-1-AP targets RETNLB in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12912

  Product name: Recombinant human RETNLB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-111 aa of BC069318

  Sequence: STQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

• Full Name: resistin like beta
• Calculated Molecular Weight: 111 aa, 12 kDa
• GenBank Accession Number: BC069318
• Gene Symbol: RETNLB
• Gene ID (NCBI): 84666
• RRID: AB_2935447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQ08
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RETNLB is an intestinal goblet cell-specific protein and is notably upregulated during intestinal inflammation. RETNLB also plays a role in several research areas, such as inflammatory disease, cancer, and metabolic function. In tumors, previous reports have suggested that positive expression of RETNLB was detected in most tissues from gastric carcinoma and colon cancer patients, RETNLB was also found involvement in oral squamous cell carcinoma [PMID: 34158059 19706296 27001185 15983036].