REXO4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86528-1-RR (same clone as 86528-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86528-1-RR (REXO4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86528-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 86528-1-RR (same clone as 86528-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using REXO4 antibody (86528-1-RR, Clone: 251440H2 ) at dilution of 1:1500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86528-1-PBS in a different storage buffer formulation.

REXO4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86528-1-PBS

Clone No.251440H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:3.1.-.-, hPMC2, PMC2, REX 4, REX4

---

Product Information

86528-1-PBS targets REXO4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13473

  Product name: Recombinant human REXO4,REX4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-422 aa of BC009274

  Sequence: WKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA

• Full Name: REX4, RNA exonuclease 4 homolog (S. cerevisiae)
• Calculated Molecular Weight: 422 aa, 47 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC009274
• Gene Symbol: REXO4
• Gene ID (NCBI): 57109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9GZR2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.