RFC1 Recombinant monoclonal antibody, PBS Only (Detector)

RFC1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85148-4-PBS
Clone No.242818H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

A1, A1 140 kDa subunit, Activator 1 140 kDa subunit, Activator 1 large subunit, Activator 1 subunit 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85148-4-PBS targets RFC1 as part of a matched antibody pair:

MP01865-2: 85148-4-PBS capture and 85148-3-PBS detection (validated in Cytometric bead array)

MP01865-3: 85148-6-PBS capture and 85148-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13585

Product name: Recombinant human RFC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 888-1147 aa of BC051751

Sequence: YIHVKPVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRKGKGKSSKK

Predict reactive species
Full Name replication factor C (activator 1) 1, 145kDa
Calculated Molecular Weight 128 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC051751
Gene Symbol RFC1
Gene ID (NCBI) 5981
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35251
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Replication factor C subunit 1 (RFC1) is a pentameric DNA polymerase accessory protein involved in DNA replication and repair (PMID: 10051561). It was reported as a cause of cerebellar ataxia with neuropathy and vestibular areflexia syndrome (CANVAS) (PMID: 30926972).

Loading...
||
New chat

Able

正在加载,请稍候...