RFC4 Polyclonal antibody

• 

  WB analysis of MCF-7 using 10806-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10806-1-AP (RFC4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 10806-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10806-1-AP (RFC4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 10806-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10806-1-AP (RFC4 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 10806-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10806-1-AP (RFC4 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 10806-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 10806-1-AP (RFC4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 10806-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10806-1-AP (RFC4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 10806-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 10806-1-AP (RFC4 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 10806-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 10806-1-AP (RFC4 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 10806-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using RFC4 antibody (10806-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of U2OS using 10806-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using RFC4 antibody (10806-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 10806-1-AP

  Immunofluorescent analysis of HepG2 cells, using RFC4 antibody 10806-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  FC experiment of HepG2 using 10806-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug RFC4 Polyclonal antibody (10806-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

RFC4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 10806-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

A1, RF-C 37 kDa subunit, RFC37

---

Tested Applications

• Positive WB detected in: MCF-7 cells, LNCaP cells, Raji cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells, HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

10806-1-AP targets RFC4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1234

  Product name: Recombinant human RFC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-363 aa of BC017452

  Sequence: MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC

• Full Name: replication factor C (activator 1) 4, 37kDa
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC017452
• Gene Symbol: RFC4
• Gene ID (NCBI): 5984
• RRID: AB_2178477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35249
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Aging (Albany NY); The upregulated expression of RFC4 and GMPS mediated by DNA copy number alteration is associated with the early diagnosis and immune escape of ESCC based on a bioinformatic analysis.; Authors - Jing Wang
mouse	WB	Cell Rep; Cyclin N-Terminal Domain-Containing-1 Coordinates Meiotic Crossover Formation with Cell-Cycle Progression in a Cyclin-Independent Manner.; Authors - Stephen Gray
human	WB	Cell Rep; TRPS1 drives heterochromatic origin refiring and cancer genome evolution.; Authors - Jianguo Yang