RFC4 Monoclonal antibody

• 

  WB analysis using 68390-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68390-1-Ig (RFC4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control.

• 

  FC experiment of HepG2 using 68390-1-Ig

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug RFC4 Monoclonal antibody (68390-1-Ig, Clone:1A6A11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

RFC4 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 68390-1-Ig

Clone No.1A6A11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

Synonyms

RFC37, RF-C 37 kDa subunit, A1, 1A6A11

---

Tested Applications

• Positive WB detected in: U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68390-1-Ig targets RFC4 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33295

  Product name: Recombinant human RFC4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-363 aa of BC017452

  Sequence: MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC

• Full Name: replication factor C (activator 1) 4, 37kDa
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC017452
• Gene Symbol: RFC4
• Gene ID (NCBI): 5984
• RRID: AB_3085108
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P35249
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.