RFX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RFX1 Polyclonal antibody (26859-1-AP)

• Featured Product
• KD/KO Validated

RFX1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26859-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EF C, Enhancer factor C, Regulatory factor X 1, RFX, RFX1, Transcription factor RFX1

• 

  WB analysis of Jurkat using 26859-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26859-1-AP (RFX1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 26859-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 26859-1-AP (RFX1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 26859-1-AP

  IP result of anti-RFX1 (IP:26859-1-AP, 4ug; Detection:26859-1-AP 1:500) with Jurkat cells lysate 2030 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RFX1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HL-60 cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26859-1-AP targets RFX1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25442

  Product name: Recombinant human RFX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 62-289 aa of BC049826

  Sequence: QPQAQPPGGQKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQGTQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPH

• Full Name: regulatory factor X, 1 (influences HLA class II expression)
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC049826
• Gene Symbol: RFX1
• Gene ID (NCBI): 5989
• RRID: AB_2880659
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22670
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RFX1, also named as MHC class II regulatory factor RFX1, is a 979 amino acid protein which contains 1 RFX-type winged-helix DNA-binding domain and belongs to the RFX family. RFX1 can binds DNA as a homodimer and heterodimerizes with RFX2 and RFX3. RFX1 as a regulatory factor is essential for MHC class II genes expression. RFX1 protein is modified after translation and its molecular weight could be migrate to 130-140 kDa (PMID: 20189986 ).

Publications

What published studies show

The RFX1 Polyclonal antibody (Cat# 26859-1-AP) has 6 citations published in Int J Biol Sci, Int J Surg, Oncol Res, Ren Fail, J Integr Neurosci, and Biomolecules. Research fields span hepatocellular carcinoma metastasis, ischemic stroke, colon cancer immunotherapy, obstructive nephropathy, pituitary neuroendocrine tumor cuproptosis, and diabetic encephalopathy. Applications include WB, IF, and IHC in human and mouse models.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	IF,WB	Int J Biol Sci; Hypoxia-induced exosomes facilitate lung pre-metastatic niche formation in hepatocellular carcinoma through the miR-4508-RFX1-IL17A-p38 MAPK-NF-κB pathway; Authors - Wentao Jia ; KD Validated
mouse	WB	Int J Surg; Neuronal PD-L1 suppression attenuates ischemic stroke injury via PD-1/RFX1 axis-mediated microglial polarization.; Authors - Fangyuan Cheng
human	WB,IHC	Oncol Res; RFX1 Regulates Immune Microenvironment and Predicts Immunotherapy Response in Colon Cancer: A Multi-Omics and Clinical Analysis.; Authors - Zhujiang Dai ; KD Validated
human,mouse	IHC	Ren Fail; Proteomics reveals the key transcription-related factors mediating obstructive nephropathy in pediatric patients and mice; Authors - Hualin Cao
human	WB	J Integr Neurosci; Single-Cell and Integrative Analyses Uncover Therapeutic Potential of RFX1-Mediated Cuproptosis in PitNETs.; Authors - Shuangjian Yang ; KD Validated
		Biomolecules; DISC1 Orchestrates Mitochondrial Calcium Overload in Diabetic Encephalopathy Through a Dual Nucleocytoplasmic Mechanism.; Authors - Lu He