RFX1 Polyclonal antibody

• 

  WB analysis of Jurkat using 26859-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26859-1-AP (RFX1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 26859-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 26859-1-AP (RFX1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 26859-1-AP

  IP result of anti-RFX1 (IP:26859-1-AP, 4ug; Detection:26859-1-AP 1:500) with Jurkat cells lysate 2030 ug.

• Featured Product
• KD/KO Validated

RFX1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26859-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EF C, Enhancer factor C, Regulatory factor X 1, RFX, RFX1, Transcription factor RFX1

---

Tested Applications

• Positive WB detected in: Jurkat cells, HL-60 cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

26859-1-AP targets RFX1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25442

  Product name: Recombinant human RFX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 62-289 aa of BC049826

  Sequence: QPQAQPPGGQKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQGTQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPH

• Full Name: regulatory factor X, 1 (influences HLA class II expression)
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: BC049826
• Gene Symbol: RFX1
• Gene ID (NCBI): 5989
• RRID: AB_2880659
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22670
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RFX1, also named as MHC class II regulatory factor RFX1, is a 979 amino acid protein which contains 1 RFX-type winged-helix DNA-binding domain and belongs to the RFX family. RFX1 can binds DNA as a homodimer and heterodimerizes with RFX2 and RFX3. RFX1 as a regulatory factor is essential for MHC class II genes expression. RFX1 protein is modified after translation and its molecular weight could be migrate to 130-140 kDa (PMID: 20189986 ).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	IF,WB	Int J Biol Sci; Hypoxia-induced exosomes facilitate lung pre-metastatic niche formation in hepatocellular carcinoma through the miR-4508-RFX1-IL17A-p38 MAPK-NF-κB pathway; Authors - Wentao Jia ; KD Validated
human,mouse	IHC	Ren Fail; Proteomics reveals the key transcription-related factors mediating obstructive nephropathy in pediatric patients and mice; Authors - Hualin Cao