RFX6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RFX6 Polyclonal antibody (22551-1-AP)

• Featured Product
• KD/KO Validated

RFX6 Polyclonal Antibody for WB, IP, ELISA

Cat No. 22551-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

DNA binding protein RFX6, DNA-binding protein RFX6, Regulatory factor X 6, Regulatory factor X domain-containing protein 1, regulatory factor X, 6

• 

  WB analysis of Caco-2 using 22551-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 22551-1-AP (RFX6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Caco-2 using 22551-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 22551-1-AP (RFX6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 22551-1-AP

  IP result of anti-RFX6 (IP:22551-1-AP, 4ug; Detection:22551-1-AP 1:500) with HEK-293 cells lysate 1800 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RFX6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22551-1-AP targets RFX6 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18235

  Product name: Recombinant human RFX6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 586-928 aa of BC039248

  Sequence: SDAVKNESHVETTYLPLPSSQPGGLGPALHQFPAGNTDNMPLTGQMELSQIAGHLMTPPISPAMASRGSVINQGPMAGRPPSVGPVLSAPSHCSTYPEPIYPALPQANHDFYSTSSNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQLSRDFFSGSCAGSPYNSRPPSSYGPSLQAQDSHNMQFLNTGSFNFLSNTGAASCQGATLPPNSPNGYYGSNINYPESHRLGSMVNQHVSVISSIRSLPPYSDIHDPLNILDDSGRKQTSSFYTDTSSPVACRTPVLASSLQTPIPSSSSQCMYGTSNQYPAQETLDSHGTSSREMVSSLPPINTVFMGTAAGGT

• Full Name: regulatory factor X, 6
• Calculated Molecular Weight: 928 aa, 102 kDa
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: BC039248
• Gene Symbol: RFX6
• Gene ID (NCBI): 222546
• RRID: AB_2879120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8HWS3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The RFX proteins represent an essential class II transcription factor family that share several conserved regions, including a centrally located DNA-binding domain (DBD) and a C-terminal D region that facilitates dimerization. RFX6, also known as RFXDC1, is a 928 amino acid nuclear protein that, via interactions with other RFX proteins, can bind DNA and is thought to activate the transcription of target genes. RFX6 is specifically expressed in pancreas, small intestine and colon. Mutations in the gene encoding RFX6 is the cause of the Mitchell-Riley syndrome (MIRIS), which is characterized by neonatal diabetes, duodenal and jejunal atresia, a hypoplastic or annular pancreas and absent gallbladder.

Publications

What published studies show

The RFX6 Polyclonal antibody (Cat# 22551-1-AP) has 1 total citation. It appears in Clinical and Translational Medicine (IF 7.9), published in December 2023. The cited study investigated how RFX6 promotes aerobic glycolysis-mediated growth and metastasis of hepatocellular carcinoma by targeting PGAM1. The research fields associated with this citation include cancer metabolism, hepatocellular carcinoma, and tumor metastasis. The antibody was used in Western blot and immunohistochemistry applications on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Clin Transl Med; RFX6 facilitates aerobic glycolysis-mediated growth and metastasis of hepatocellular carcinoma through targeting PGAM1; Authors - Zhiyu Qiu ; KD Validated