RGP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RGP1 Polyclonal antibody, PBS Only (19908-1-PBS)

• 

  WB analysis using 19908-1-AP (same clone as 19908-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19908-1-AP (RGP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19908-1-PBS in a different storage buffer formulation.

RGP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 19908-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

RAB6A-GEF complex partner protein 2

---

Product Information

19908-1-PBS targets RGP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13902

  Product name: Recombinant human RGP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-391 aa of BC001725

  Sequence: MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI

• Full Name: RGP1 retrograde golgi transport homolog (S. cerevisiae)
• Calculated Molecular Weight: 391 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC001725
• Gene Symbol: RGP1
• Gene ID (NCBI): 9827
• RRID: AB_3741972
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92546
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.