RGS10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RGS10 Polyclonal antibody (11163-1-AP)

• Featured Product
• KD/KO Validated

RGS10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11163-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Regulator of G-protein signaling 10

• 

  WB analysis of mouse thymus using 11163-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11163-1-AP (RGS10 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 11163-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11163-1-AP (RGS10 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 11163-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11163-1-AP (RGS10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 11163-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11163-1-AP (RGS10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 11163-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11163-1-AP (RGS10 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RGS10 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, K-562 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11163-1-AP targets RGS10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1644

  Product name: Recombinant human RGS10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC009361

  Sequence: MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

• Full Name: regulator of G-protein signaling 10
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 20-22 kDa
• GenBank Accession Number: BC009361
• Gene Symbol: RGS10
• Gene ID (NCBI): 6001
• RRID: AB_10596933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43665
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-RGS10 antibody (Cat# 11163-1-AP) has 3 citations published in International Endodontic Journal, Journal of Endodontics, and Oral Diseases. All studies used Western blot in mouse models. The research fields center on apical periodontitis, with investigations into TFEB-mediated autophagy regulation, NF-κB pathway upregulation, and collagen-induced arthritis, highlighting RGS10's role in inflammatory and immune responses in periodontal disease.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int Endod J; RGS10 negatively regulates apical periodontitis via TFEB-mediated autophagy in BABL/c mice model and in vitro; Authors - Jiaxin Li
mouse	WB	J Endod; Inhibition of RGS10 Aggravates Periapical Periodontitis via Upregulation of the NF-κB Pathway; Authors - Wei Wei
mouse	WB	Oral Dis; Inhibition of Rgs10 aggravates periodontitis with collagen-induced arthritis via the NF-κB pathway.; Authors - Wei-Cheng Chan ; KD Validated