RGS18 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RGS18 Polyclonal antibody (11866-1-AP)

RGS18 Polyclonal Antibody for WB, ELISA

Cat No. 11866-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

Regulator of G-protein signaling 18

• 

  WB analysis using 11866-1-AP

  human peripheral blood leukocyte sample were subjected to SDS PAGE followed by western blot with 11866-1-AP (RGS18 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RGS18 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11866-1-AP targets RGS18 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2445

  Product name: Recombinant human RGS18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC020632

  Sequence: METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL

• Full Name: regulator of G-protein signaling 18
• Calculated Molecular Weight: 235 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC020632
• Gene Symbol: RGS18
• Gene ID (NCBI): 64407
• RRID: AB_2877800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NS28
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RGS18 Polyclonal antibody (Cat# 11866-1-AP) has 1 citation, published in International Journal of Molecular Medicine (2024). The study investigated RGS18's role in promoting osteocyte proliferation via ERK signaling pathway activation in mouse models, using WB as the application. The research falls within the fields of bone biology and intracellular signaling transduction.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int J Mol Med; Regulator of G protein signalling 18 promotes osteocyte proliferation by activating the extracellular signal‑regulated kinase signalling pathway; Authors - Yong Meng