RGS19 Polyclonal antibody

• 

RGS19 Polyclonal Antibody for ELISA

Cat No. 11761-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

G alpha interacting protein, GAIP, GNAI3IP, RGS19, RGSGAIP

---

Product Information

11761-1-AP targets RGS19 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2358

  Product name: Recombinant human RGS19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC001318

  Sequence: MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA

• Full Name: regulator of G-protein signaling 19
• Calculated Molecular Weight: 217 aa, 25 kDa
• GenBank Accession Number: BC001318
• Gene Symbol: RGS19
• Gene ID (NCBI): 10287
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49795
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.