RGS22 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RGS22 Polyclonal antibody (28231-1-AP)

• 

  IHC staining of mouse testis using 28231-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28231-1-AP (RGS22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 28231-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28231-1-AP (RGS22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 28231-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28231-1-AP (RGS22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RGS22 Polyclonal Antibody for IHC, ELISA

Cat No. 28231-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

regulator of G protein signaling 22, Regulator of G-protein signaling 22, RGS 22

---

Tested Applications

• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28231-1-AP targets RGS22 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28156

  Product name: Recombinant human RGS22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-499 aa of BC092411

  Sequence: HPRTKKDPSKTNKLISEFEEEEGEEEEVSVSLQDTPSQALLRVYLEKKQDVDESLTMHFSTCEEFLSSYIYFILRGAIQQIVGKPVGETPDYINFNNITKVSFDDCFESIHGKNFLSELVQTTKERSEEIEQTSLSSKNESAGPESRADWCISHRTYDIGNRKEFERFKKFIKGTLGERYWWLWMDIERLKVLKDPGRHQRHLEKMKKCYLVSNGDYYLSAEILSKFKLLDGSQWNEEHLRNIQSEVLKP

• Full Name: regulator of G-protein signaling 22
• Calculated Molecular Weight: 1263 aa, 147 kDa
• GenBank Accession Number: BC092411
• Gene Symbol: RGS22
• Gene ID (NCBI): 26166
• RRID: AB_3742287
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NE09
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The RGS22 protein (Regulator of G-protein signaling 22) belongs to the regulators of G-protein signaling (RGS) protein family and is a member of the RA/RGS subfamily. Its protein structure contains at least three conserved RGS domains. RGS22 primarily functions as a GTPase-activating protein (GAP) by binding to the G protein α subunit and enhancing its GTPase activity, thereby promoting the conversion of G proteins from an active state to an inactive state, which negatively regulates downstream signal transduction of G protein-coupled receptors.