Tested Applications
| Positive WB detected in | mouse brain tissue, HEK-293 cells, HeLa cells, SH-SY5Y cells, rat brain tissue |
| Positive IP detected in | HeLa cells, mouse brain tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:150-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14326-1-AP targets RHOB in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5593 Product name: Recombinant human RHOB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC066954 Sequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL Predict reactive species |
| Full Name | ras homolog gene family, member B |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 22-26 kDa |
| GenBank Accession Number | BC066954 |
| Gene Symbol | RHOB |
| Gene ID (NCBI) | 388 |
| RRID | AB_2179092 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62745 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Rho-related GTP-binding protein RhoB (RHOB) is also named ARH6, ARHB and Rho cDNA clone 6 (h6). RhoB was the first member of the Rho family to be implicated in endosomal trafficking. One study showed that RhoB localizes and activates its downstream target, serine/threonine kinase (PRK1), on endosomes, and acts through this signaling pathway to disrupt the trafficking of internalized EGF receptor from endosomes to a prelysosomal compartment (PMID: 29385717). RhoB is known to be part of the immediate early genetic response to epidermal growth factor, transforming growth factor β, Src activation, or genotoxic stress (PMID:9545335, PMID: 10679283). RhoB was shown to have potential implications for EGF signaling by targeting the activated EGF receptors to the lysosome, which represents an "off-switch" for mitogenic signals (PMID: 1050858). RhoB was also demonstrated to exert a negative regulatory influence on TGF-β-induced transcriptional activation (PMID:9545335). The activity of the RhoB promoter was stimulated by genotoxic treatments indicating its role in the cellular response to DNA damage (PMID:9388198).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RHOB antibody 14326-1-AP | Download protocol |
| IHC protocol for RHOB antibody 14326-1-AP | Download protocol |
| IP protocol for RHOB antibody 14326-1-AP | Download protocol |
| WB protocol for RHOB antibody 14326-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RHOB Polyclonal antibody (catalog number 14326-1-AP) has 37 citations. These appear in journals including Molecular Cancer, Nature Communications, Advanced Science, Cell Death & Disease, Oncogene, EMBO Molecular Medicine, Journal of Cell Biology, Science Reports, PLoS One, BMC Cancer, Experimental Cell Research, and Molecular Cell. Research fields span cancer biology (pancreatic, liver, ovarian, prostate, lung, breast, cervical, renal, and glioma), autophagy, lipid metabolism, signaling pathways, and cell motility, with applications mainly in Western blot, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Mol Cancer Hsa-miR-3178/RhoB/PI3K/Akt, a novel signaling pathway regulates ABC transporters to reverse gemcitabine resistance in pancreatic cancer. | ||
Nat Commun ATR/Chk1 signaling induces autophagy through sumoylated RhoB-mediated lysosomal translocation of TSC2 after DNA damage.
| ||
Adv Sci (Weinh) Adducin-1 Facilitates Influenza Virus Endosomal Trafficking and Uncoating by Regulating Branched Actin Dynamics and Myosin IIB Activity | ||
Cell Death Dis Septin11 promotes hepatocellular carcinoma cell motility by activating RhoA to regulate cytoskeleton and cell adhesion | ||
Oncogene USP33 facilitates the ovarian cancer progression via deubiquitinating and stabilizing CBX2 | ||
EMBO Mol Med The RhoB p.S73F mutation leads to cerebral palsy through dysregulation of lipid homeostasis |
