RHOB Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RHOB Recombinant monoclonal antibody (86663-4-RR)

RHOB Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86663-4-RR

Clone No.251662A7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

ARH6, ARHB, h6, Rho cDNA clone 6, Rho-related GTP-binding protein RhoB

• 

  WB analysis using 86663-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86663-4-RR (RHOB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 86663-4-RR

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using RHOB antibody (86663-4-RR, Clone: 251662A7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86663-4-RR

  Biolayer interferometry (BLl) kinetic assays of 86663-4-RR against Human RHOB were performed. The affinity constant is 15.2 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, COLO 205 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86663-4-RR targets RHOB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5593

  Product name: Recombinant human RHOB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC066954

  Sequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

• Full Name: ras homolog gene family, member B
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC066954
• Gene Symbol: RHOB
• Gene ID (NCBI): 388
• RRID: AB_3745039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62745
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rho-related GTP-binding protein RhoB (RHOB) is also named ARH6, ARHB and Rho cDNA clone 6 (h6). RhoB was the first member of the Rho family to be implicated in endosomal trafficking. One study showed that RhoB localizes and activates its downstream target, serine/threonine kinase (PRK1), on endosomes, and acts through this signaling pathway to disrupt the trafficking of internalized EGF receptor from endosomes to a prelysosomal compartment (PMID: 29385717). RhoB is known to be part of the immediate early genetic response to epidermal growth factor, transforming growth factor β, Src activation, or genotoxic stress (PMID:9545335, PMID: 10679283). RhoB was shown to have potential implications for EGF signaling by targeting the activated EGF receptors to the lysosome, which represents an "off-switch" for mitogenic signals (PMID: 1050858). RhoB was also demonstrated to exert a negative regulatory influence on TGF-β-induced transcriptional activation (PMID:9545335). The activity of the RhoB promoter was stimulated by genotoxic treatments indicating its role in the cellular response to DNA damage (PMID:9388198).