RHOBTB3 Monoclonal antibody, PBS Only

• 

  WB analysis of K-562 using 67502-1-Ig (same clone as 67502-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67502-1-Ig (same clone as 67502-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67502-1-Ig (same clone as 67502-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 67502-1-Ig (same clone as 67502-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67502-1-Ig (same clone as 67502-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67502-1-Ig (same clone as 67502-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67502-1-Ig (same clone as 67502-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat adrenal gland using 67502-1-Ig (same clone as 67502-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat adrenal gland tissue slide using 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67502-1-Ig (same clone as 67502-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 67502-1-Ig (same clone as 67502-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 67502-1-Ig (same clone as 67502-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67502-1-Ig (RHOBTB3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67502-1-PBS in a different storage buffer formulation.

RHOBTB3 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67502-1-PBS

Clone No.1H2E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

1H2E3, EC:3.6.1.-, KIAA0878, Rho-related BTB domain-containing protein 3

---

Product Information

67502-1-PBS targets RHOBTB3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5782

  Product name: Recombinant human RHOBTB3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-359 aa of BC041337

  Sequence: MSIHIVALGNEGDTFHQDNQPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIKYNVNDKFSFHEVKDNYIPVIKRALNSVPVIIAAVGTRQNEELPCTCPLCTSDRGSCVSTTEGIQLAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKRKMSNSFHGIRPPQLEQPEKMPVLKAEASHYNSDLNNLLFCCQCVDVVFYNPDLKKVVEAHKIVLCAVSHVFMLLFNVKSPTDIQDSSIIRTTQDLFAINRDTAFPGASHESSGNPPLRVIVKDALFCSCLSDILRFIYSGAFQWEELEE

• Full Name: Rho-related BTB domain containing 3
• Calculated Molecular Weight: 611 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC041337
• Gene Symbol: RHOBTB3
• Gene ID (NCBI): 22836
• RRID: AB_2882726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O94955
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.