RHOC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RHOC Polyclonal antibody (10632-1-AP)

RHOC Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10632-1-AP Copied!

Publications (19)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

ARH9, ARHC, H9, Rho cDNA clone 9, Rho-related GTP-binding protein RhoC

• 

  WB analysis using 10632-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10632-1-AP (RHOC antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 10632-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 10632-1-AP (RHOC Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 10632-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10632-1-AP (RHOC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A549 using 10632-1-AP

  IP result of anti-RHOC (IP:10632-1-AP, 4ug; Detection:10632-1-AP 1:6000) with A549 cells lysate 1000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 10632-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 10632-1-AP (RHOC antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RHOC in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, NIH/3T3 cells, C6 cells, HeLa cells
• Positive IP detected in: A549 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:800-1:3200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10632-1-AP targets RHOC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0988

  Product name: Recombinant human RHOC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC007245

  Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

• Full Name: ras homolog gene family, member C
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC007245
• Gene Symbol: RHOC
• Gene ID (NCBI): 389
• RRID: AB_10898358
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08134
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ras homolog family member C (RHOC) encodes a Rho-related GTP-binding protein, which belongs to small GTPase superfamily and also Rho family. RHOC. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Expression of RHOC contributes to metastatic phenotype of melanoma cells and is associated with multiple cancers including gastric carcinomas, ovarian carcinomas and breast cancer as well.

Publications

What published studies show

The RHOC Polyclonal antibody (Cat# 10632-1-AP) has 19 citations published in journals including Cell Discovery, J Exp Clin Cancer Res, Cell Death & Disease, Oncotarget, Sci Rep, Oncol Rep, Front Mol Biosci, FASEB J, Exp Cell Res, Mol Carcinog, J Cancer, PLoS One, Gene, Tumour Biol, BBRC, Onco Targets Ther, and Open Life Sci. Research fields span cancer biology (lung, ovarian, nasopharyngeal, bladder, colon, breast, liver, glioma), cell signaling pathways (Rho/Rac, Wnt/β-catenin, PI3K/AKT), metastasis, migration, angiogenesis, and lncRNA-mediated regulation.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Discov; Long non-coding RNA MT1DP shunts the cellular defense to cytotoxicity through crosstalk with MT1H and RhoC in cadmium stress.; Authors - Ming Gao
human	WB	J Exp Clin Cancer Res; Long noncoding RNA AFAP1-AS1 acts as a competing endogenous RNA of miR-423-5p to facilitate nasopharyngeal carcinoma metastasis through regulating the Rho/Rac pathway.; Authors - Yu Lian
mouse,human	WB,IP	Cell Death Dis; Septin11 promotes hepatocellular carcinoma cell motility by activating RhoA to regulate cytoskeleton and cell adhesion; Authors - Lisheng Fu
human	WB	Oncotarget; Upregulated long non-coding RNA AFAP1-AS1 expression is associated with progression and poor prognosis of nasopharyngeal carcinoma.; Authors - Hao Bo
human	WB	Sci Rep; KIFC3 promotes the proliferation, migration and invasion of non-small cell lung cancer through the PI3K/AKT signaling pathway; Authors - Yue Ma
		Oncol Rep; Effects and mechanism of RhoC downregulation in suppressing ovarian cancer stem cell proliferation, drug resistance, invasion and metastasis.; Authors - Xiu-Bo Sang