RHOH Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RHOH Polyclonal antibody (27263-1-AP)

• 

  WB analysis using 27263-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27263-1-AP (RHOH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

RHOH Polyclonal Antibody for WB, ELISA

Cat No. 27263-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ARHH, TTF, GTP binding protein TTF, GTP-binding protein TTF, Rho-related GTP-binding protein RhoH

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27263-1-AP targets RHOH in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26127

  Product name: Recombinant human RHOH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 116-188 aa of BC014261

  Sequence: TQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINEC

• Full Name: ras homolog gene family, member H
• Calculated Molecular Weight: 191 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC014261
• Gene Symbol: RHOH
• Gene ID (NCBI): 399
• RRID: AB_3742224
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15669
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RHOH is also named ARHH and TTF. RHOH is a member of the RHO GTPase family, which orchestrates a wide range of cellular processes, such as cytoskeletal reorganization, vesicle trafficking, cell cycle, cell polarity, and cell migration (PMID: 33547421, PMID: 29233866). Unlike typical RHO GTPases that undergo cycling between inactive GDP-bound and active GTP-bound conformation, RHOH lacks intrinsic GTPase activity and remains in a constitutively GTP-bound form (PMID: 11809807). RHOH exhibits high expression in T cells and plays crucial roles in T cell development, activation and differentiation, and undergoes degradation in lysosomes following TCR stimulation (PMID: 17119112, PMID: 30339851, PMID: 19950172). RhoH has been found to regulate proliferation, survival, migration and engraftment of hematopoietic progenitor cells (HPCs), IL-3 signaling in a B cell line, FcεRI-dependent signal transduction in mast cells, and differentiation in eosinophils (PMID: 36108062).